LL-37 Peptide Sequence – Why Molecular Identity Matters When Buying
Researchers searching for the LL-37 peptide sequence may initially appear to have informational intent.
However, sequence verification can also play an important role in research-product procurement.
Before purchasing an LL-37 research peptide, researchers should understand exactly which molecular material they intend to obtain.
LL-37 isn’t simply a generic “immune peptide.”
It is a defined 37-amino-acid peptide.
What Is the LL-37 Peptide Sequence?
The LL-37 sequence is:
[LL-37, 37 aa]
The name LL-37 reflects the peptide beginning with two leucine residues—LL—and containing 37 amino-acid residues.
Sequence information provides an important reference when evaluating molecular identity.
Why Does Sequence Matter When Purchasing LL-37?
Research protocols depend on specific compounds.
If a study calls for LL-37, researchers should verify that the commercial research product corresponds to the intended peptide.
Sequence information can help distinguish LL-37 from:
- Its precursor
- Related cathelicidin terminology
- Peptide fragments
- Modified sequences
- Other experimental peptides
The product name alone shouldn’t replace careful identity verification.
LL-37 and hCAP18 Are Related but Different
One of the most important terminology distinctions involves:
LL-37
and
hCAP18
hCAP18 is the human cathelicidin precursor.
LL-37 is the mature 37-residue C-terminal peptide generated from that precursor.
Scientific literature may discuss both within the same biological context.
That doesn’t make the molecular terms interchangeable for procurement.
Browse LL-37 Research Products
Current LL-37 listings can be reviewed here:
https://peptideslabus.com/products?q=LL-37
Researchers can use the catalog to compare available research products.
LL-37 5mg Product
A specific 5mg listing is available here:
https://peptideslabus.com/products/ll-37-5mg-research-peptide
Researchers should verify current specifications directly from the product page.
Additional LL-37 Listings
Other research listings include:
https://peptideslabus.com/products/crown-ll-37-research-peptide
and:
https://peptideslabus.com/products/peptides-lab-ll37
Each listing should be evaluated according to the actual specifications and documentation provided.
Sequence Doesn’t Tell You Quantity
Knowing the LL-37 sequence doesn’t tell researchers how much material is present in a vial.
These are separate specifications.
For example:
[LL-37, 37 aa]
describes sequence identity.
5mg
describes nominal quantity.
Both can matter during procurement.
Sequence Doesn’t Establish Purity
Likewise, the correct sequence written on a product page doesn’t independently establish analytical purity.
Researchers should examine available purity testing.
Sequence Doesn’t Replace Analytical Identity Testing
A listed sequence is a useful reference.
It isn’t the same thing as experimentally confirming that the material in a particular sample corresponds to the expected compound.
Researchers should therefore review available identity-related analytical information.
HPLC and LL-37 Identity
HPLC can provide useful information regarding chromatographic purity.
However, chromatographic purity shouldn’t automatically be treated as complete molecular identity confirmation.
Researchers should understand what each analytical method is intended to establish.
Review the COA
A Certificate of Analysis may help connect the product with analytical results.
Researchers should look for information such as:
- Product identity
- Batch/lot
- Purity
- Analytical method
- Identity-related results
- Additional specifications
The COA should be evaluated based on its actual content.
Batch Documentation Matters
Researchers should determine whether the analytical documentation corresponds to the batch being considered.
This is particularly important when analytical reports remain online after inventory changes.
Why Molecular Identity Matters in LL-37 Research
LL-37 has been investigated in experimental systems involving:
- Innate immunity
- Host-defense biology
- Microbial interactions
- Inflammatory signaling
- Cytokines
- Epithelial cells
- Cellular responses
- Nucleic-acid-associated immune mechanisms
When interpreting this literature, researchers need confidence that the compound being studied corresponds to the compound described in the research protocol.
Don’t Use Biological Function as Product Identity
Descriptions such as:
antimicrobial peptide
host-defense peptide
or
immune peptide
can describe scientific categories.
They don’t uniquely identify LL-37.
Exact compound identification remains necessary.
LL-37 Molecular Identity Checklist
Before purchasing:
- Confirm the product is LL-37.
- Verify the 37-residue sequence.
- Distinguish LL-37 from hCAP18.
- Check whether modifications are disclosed.
- Confirm the listed quantity.
- Review purity information.
- Examine HPLC documentation.
- Review identity-related analytical information.
- Examine the COA.
- Match documentation with the relevant batch.
- Verify current price and availability.
Browse Current LL-37 Research Products
https://peptideslabus.com/products?q=LL-37
For research procurement, knowing the LL-37 peptide sequence helps establish what researchers intend to purchase, while analytical documentation helps evaluate whether a specific research product is consistent with that intended identity.
For laboratory research purposes only.